COPE Media Kit

Cope Home
Previous entry:
gastric foveolar mucous cells
Next entry:
gastric inhibitory peptide(7-42)
Random entry:
Search COPE:

gastric inhibitory peptide

abbr. and approved gene symbol: GIP (a term with multiple meanings). Also: gastric inhibitory polypeptide. This name has been given by Brown and Dryburgh (1971) to a peptide isolated from intestinal mucosa. The peptide, YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ, was named thus because exogenous administration inhibits gastric acid secretion and gastrointestinal motility in dogs. Following the discovery that this peptide also possesses insulinotropic properties and thus acts as an incretin, the new name glucose-dependent insulinotropic peptide (glucose-dependent insulinotropic polypeptide; same acronym: GIP ... ... ... ... ... Subscribe to continue reading! ... ...


Content view restricted !

COPE - with 54500+ entries the most comprehensive cell-to-cell communication knowledge base

Extensive In-depth and In Context Information covering terminology, nomenclature, concepts, strategies & complexities of cellular communication, including Acute phase proteins | Angiogenesis | Antimicrobial & host defense peptides | Apoptosis & other forms of cell death | CD antigens | Cell lines | Cell reprogramming | Chemokines | Cryptides | Cytokines & Growth factors | CytokineTopics | Eukaryotic cell types & expression profiles | Hematopoiesis | Hormones | Inflamation & inflammatory mediators | Innate Immunity | Metalloproteinases | Microvesicles / Microparticles | Moonlighting proteins & cryptides | Neuropeptides | Non-coding RNAs | Pathogenicity & Virulence Factors | Pattern recognition receptors | Peptide sequences | Protein domains | Regulatory peptide factors | Viroceptors | Virokines and more.

Full COPEing for subscribers:

Access to Alphabet bar, Freetext search, Leafing/browsing functions, Internal Backlinking, Topic-specific introductions, Topic-specific integrated subdictionaries, Scientific references with PubMed links

with a 15 USD/month subscription at

See example pages at the bottom of the home page
The others just sisyphos around


Copyright © 1997-2021. All rights reserved by Dr H Ibelgaufts, the author of COPE - Cytokines & Cells Online Pathfinder Encyclopaedia


SUPPORT COPE | Intro | Subdictionaries | New Entries | Contribute data | COPE Credentials
# A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

              Created, developed, and maintained by Dr H Ibelgaufts              
About the author of COPE
  |    Contact COPE   |    Terms & Conditions

U L T R A   P O S S E    N E M O   O B L I G A T U R

cope.cgi Version 1.41 [08.12.2020]. (c) JI. Powered by Perl 5.028001. key=20412