melanin-macrophages |
melanoblasts |
HMGB2 |
||
abbr. MRCH. Also: PBAN-1 [pheromone biosynthesis-activating neuropeptide 1]. This insect neurohormone (LSEDMPATPADQEMYQPDPEEMESRTRYFSPRL) has been isolated by Matsumoto et al (1986) from heads of adult Bombyx mori. Injection of the hormone elicits cvuticular melanization in larvae of the common armyworm, Leucania separata, a process that is observed also in the life cycle of this insect during the gregarious phase. Three species of this hormone have been identified. They show N-terminal heterogeneity. N-terminal amino acid sequences reveal sequence homology with the C-terminal region of human IGFBP2 (Matsumoto et al, 1985).
See also:
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |