COPE Media Kit


Cope Home
Previous entry:
phosphatidylserine binding protein p68
Next entry:
phosphaturic factor
Random entry:
CIAKGNGCQPSGVQGNCCSGHCHKEPGWVAGYCK
Search COPE:

phosphatonin

This generic term pertains to circulating factor(s) (also referred to as phosphaturic factors) that directly act on the kidney to induce renal serum phosphate wasting when they are present at high serum concentrations (White et al, 2006). Phosphaturic factors have been shown to be secreted by certain tumors and are thought to be responsible for osteomalacia, a hypophosphatemic disease characterized by renal phosphate wasting. Removal of responsible tumors normalizes phosphate metabolism (Kumar, 2000; Strewler et al, 2001).

One of these factors has been identified by studies of patients with hypophosphatemic rickets/osteomalacia as FGF23. Other phosphatonin-like polypeptides are sFRP4 [secreted frizzled-related protein 4], which is a secreted member of the ... ... ... ... ... Subscribe to continue reading! ... ...

 

Content view restricted !

COPE - with 54500+ entries the most comprehensive cell-to-cell communication knowledge base

Extensive In-depth and In Context Information covering terminology, nomenclature, concepts, strategies & complexities of cellular communication, including Acute phase proteins | Angiogenesis | Antimicrobial & host defense peptides | Apoptosis & other forms of cell death | CD antigens | Cell lines | Cell reprogramming | Chemokines | Cryptides | Cytokines & Growth factors | CytokineTopics | Eukaryotic cell types & expression profiles | Hematopoiesis | Hormones | Inflamation & inflammatory mediators | Innate Immunity | Metalloproteinases | Microvesicles / Microparticles | Moonlighting proteins & cryptides | Neuropeptides | Non-coding RNAs | Pathogenicity & Virulence Factors | Pattern recognition receptors | Peptide sequences | Protein domains | Regulatory peptide factors | Viroceptors | Virokines and more.

Full COPEing for subscribers:

Access to Alphabet bar, Freetext search, Leafing/browsing functions, Internal Backlinking, Topic-specific introductions, Topic-specific integrated subdictionaries, Scientific references with PubMed links

with a 15 USD/month subscription at Cells-Talk.com

See example pages at the bottom of the Cells-Talk.com home page
THE SMART ONES COPE
The others just sisyphos around

 

Copyright © 1997-2021. All rights reserved by Dr H Ibelgaufts, the author of COPE - Cytokines & Cells Online Pathfinder Encyclopaedia

ENTRY LAST MODIFIED: June 2011



 
 
SUPPORT COPE | Intro | Subdictionaries | New Entries | Contribute data | COPE Credentials
# A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

              Created, developed, and maintained by Dr H Ibelgaufts              
About the author of COPE
  |    Contact COPE   |    Terms & Conditions


U L T R A   P O S S E    N E M O   O B L I G A T U R



cope.cgi Version 1.41 [08.12.2020]. (c) JI. Powered by Perl 5.032001. key=40212