phosphatidylserine binding protein p68 |
phosphaturic factor |
CIAKGNGCQPSGVQGNCCSGHCHKEPGWVAGYCK |
||
This generic term pertains to circulating factor(s) (also referred to as phosphaturic factors) that directly act on the kidney to induce renal serum phosphate wasting when they are present at high serum concentrations (White et al, 2006). Phosphaturic factors have been shown to be secreted by certain tumors and are thought to be responsible for osteomalacia, a hypophosphatemic disease characterized by renal phosphate wasting. Removal of responsible tumors normalizes phosphate metabolism (Kumar, 2000; Strewler et al, 2001).
One of these factors has been identified by studies of patients with hypophosphatemic rickets/osteomalacia as FGF23. Other phosphatonin-like polypeptides are sFRP4 [secreted frizzled-related protein 4], which is a secreted member of the
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |