BGPx |
BGPz |
VTCDLLSFKGQVNDSACAANCLSLGKAGGHCEKVGCICRKTSFKDLWDKRF |
||
[biliary glycoprotein y] This is a splice variant of BGP-1 [biliary glycoprotein 1].
In the nomenclature of CD antigens this protein, which is a splice variant of CEACAM1, designated CEACAM1-3AL, has been given the designation CD66. For additional information on CD antigens see also: CD antigens Dictionary.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |