blr-1 ligand |
BLSCs |
HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA |
||
[Burkitt lymphoma receptor-2] This gene was isolated by its homology to blr-1 [Burkitt lymphoma receptor-1], a receptor expressed in Burkitt's lymphoma cells and B-lymphocytes, and as one of several cellular genes induced by Epstein-Barr virus. EBI-1 (Epstein-Barr Virus induced gene 1) is almost completely identical with blr-2. It has been proposed to designate both genes as CCR7. See also: CDw197.
For additional information on CD antigens see also: CD antigens Dictionary.
The blr-2 gene is expressed specifically in lymphoid tumor cell lines but not in neuronal and undifferentiated myeloid cell
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |