AMVSEFLKQAWFIENEEQEYVQTVKSC |
AMWKDVLKKIGTVALHAGKAALGAVADTISQ |
Gregory antigen |
||
[activated microglia/macrophage WAP domain protein] This protein of 76 amino acids has been identified by Karlstetter et al (2010). The protein contains a WAP domain. Its expression appears to be restricted to microglial cells and macrophages. Expression is observed in microglial cells upon stimulation with multiple ligands of TLR receptors (TLR2, TLR4, TLR9) and IFN-gamma. In databanks the protein is being referred to also as Wfdc17 [WAP four-disulfide core domain 17].
AMWAP overexpression reduces the pro-inflammatory cytokines IL6 and IL1-beta
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |