Adrenomedullin binding protein-1 |
Adrenotensin(163-183) |
Kininogen-1 |
||
abbr. ADT. This peptide, (proADM[153-185]) (SLPEAGPGRTLVSSKPQAHGAPAPPSGSAPHFL) corresponds to amino acids 153-185 of the adrenomedullin precursor, from which it is believed to arise by proteolytic cleavage (Gumusel et al, 1995). The cleavage product may act in a modulatory manner to influence vasorelaxation in response to Adrenomedullin (Gumusel et al, 1996).
Zhou et al (2000) have reported that adrenotensin effects are inhibited by Adrenomedullin and that adrenotensin decreases adrenomedullin release rates. Xue et al (2009) have reported that adrenotensin promotes proliferation of renal mesangial cells and also increases TGF-beta-1 and collagen type 4
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |