analgesic-antitumor peptide |
ANAP |
APKWKIFKKIEHMGQNIRDGLIKAGPAVQVVGQAATIYKG |
||
Anamorsin was isolated originally as a molecule conferring resistance to cell death by apoptosis induced by growth factor deprivation, using variants of factor-dependent cell lines that do not undergo cell death in response to growth factor withdrawal (Shibayama et al, 2004). The protein does not show any homology to other proteins known to regulate cell death by apoptosis. The gene encoding anamorsin is named CIAPIN1 [cytokine-induced apoptosis inhibitor 1].
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |