grass |
gray platelet syndrome |
HGPDSCNHDRGLCRVGNCNPGEYLAKYCFEPVILCCKPLSPTPTKT |
||
a 250 kDa intracellular protein (1,780 amino acids), originally identified as a cytoplasmic antigen recognized by myasthenia gravis sera (Gordon et al, 1992; Sasaki et al, 2001). Autoantibodies to gravin are highly specific for myasthenia gravis. (Nauert et al, 1997; Sasaki et al, 2001). The protein is known also as human AKAP250 [A-kinase anchor protein 250 kDa; cAMP-dependent protein kinase-anchor protein 250]), AKAP12 [A-kinase anchor protein 12; approved gene symbol], or SSeCKS [src-suppressed C kinase substrate], a rat ortholog, the expression of which in astrocytes
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |