IFGSIYHRKCVVKNRCETVSGHKTCKDLTCCRAVIFRHERPEVCRPQT |
Ifi10 |
squamous epithelial cells |
||
approved gene symbol [Interferon alpha-inducible protein 6]. The gene is being referred to also as Ifi-6-16 [Interferon-induced protein 6-16]. A previous designation is G1P3. A databank synonym is FAM14C [family with sequence similarity 14 member C].
The human gene, identified originally as a gene expressed strongly in response to IFN-alpha and IFN-beta, has been termed 6-16 by Kelly et al (1986). Turri et al (1995) have reported several splice variants. Parker and Porter (2004) have characterized the human gene, for which there does not seem to exist a
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |