Immunoglobulin superfamily receptor translocation associated 1 |
Immunoglobulin superfamily receptor translocation associated 3 |
SGISGPLSCGRNGGVCIPIRCPVPMRQIGTCFGRPVKCCRSW |
||
see: IRTA2. In the nomenclature of CD antigens this protein has been given the designation CD307e (Matesanz-Isabel et al, 2011). Note that the previously used designation was CD307.
For additional information on CD antigens see also: CD antigens Dictionary.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |