MSK21 |
MSKLAEAIANTVKAAQDQDWTKLGTSIVDIVESGVSVLGKIFGF |
Period2 |
||
Rettig et al (1990) have referred to this gene symbol as the gene encoding antigen 5.1.H11, recognized by a monoclonal antibody of the same name. The antigen in question is NCAM1 [neural cell adhesion molecule-1].
In the nomenclature of CD antigens this protein has been given the designation CD56.
For additional information on CD antigens see also: CD antigens Dictionary.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |