OB-RS |
O-[Chloroacetylcarbamoyl]-Fumagillol |
RNM561 |
||
Obtustatin (CTTGPCCRQCKLKPAGTTCWKTSLTSHYCTGKSCDCPLYPG) is a disintegrin isolated from the venom of the Vipera lebetina obtusa viper. The protein does not contain the classical RGD sequence characteristic of other integrins.
Obtustatin is a potent and selective inhibitor of the binding of integrin-alpha-1 / integrin-beta-1 to collagen type 4. For a more potent related factor see also: Viperistatin.
Obtustatin has been shown to be a potent inhibitor of angiogenesis in vivo in the chicken chorioallantoic membrane assay and also blocks neovascularization of in transplanted Lewis lung tumors transplanted into nude mice (Marcinkiewicz et al, 2003).
See also:
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |