pentraxin-related gene rapidly induced by IL1-beta |
Pep-1 |
CG5680 |
||
[permeability-enhancing peptide] This peptide (EMILNGINNYKNPKLTRMLTFKFYMPKKATELKHLQC) comprises amino acids 22-58 of IL2 (IL2[22-58], Interleukin-2[22-58]). When conjugated to a tumor-targeting antibody, it increases vasopermeability in vivo (leaky tumor endothelium), to the same extent as IL2. This results in an increase in antibody uptake in xenotransplanted human tumors in experimental animals. The peptide is active only in its conjugated form and has no IL2 bioactivities.
For other proteins (or fragments thereof) with at least one additional activity that differs from the established 'classical' activity of the parent protein see also:
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |