PIC1 |
PICA peptide |
LVQRGRFGRFLRKIRRFRPKVTITIQGSARFG |
||
[p53-induced CD28-dependent T-cell apoptosis] This term pertains to cell death by apoptosis observed with T-cells. Seki et al (2010) have shown that natural regulatory T-cells survive and expand when stimulated with immobilized antibodies against CD3 and CD28 with the added presence of IL2, whereas non-regulatory T-cells undergo cell death by apoptosis. Unlike classical Activation-induced cell death, this form of apoptosis depends on p53 and requires engagement of CD28. Unlike conventional T-cells, natural regulatory T-cells
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |