Parkerin |
parkin-associated endothelin receptor-like receptor |
VRNFVTCRINRGFCVPIRCPGHRRQIGTCLGPQIKCCR |
||
abbr. PRKN. The approved gene symbol is PARK2 [parkinson protein 2; Parkinson disease protein 2, Parkinson juvenile disease protein 2]. Huynh et al (2000) have reported expression of parkin in neuronal processes and cell bodies of neurons, but not glial cells, in the midbrain, basal ganglia, cerebral cortex, and cerebellum in association with actin filaments.
Parkin is an E3 ubiquitin ligase containing a RING domain
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |