phoenixin-20amide |
phoenixin-26 |
KSHV orfK9 |
||
abbr. PNX. This secreted peptide, YPIYFRPLMRLEEYKKEQAINRAGIVQEDVQPPGLKVWSDPFGRK, has been described by Yosten et al (2013). Sequence analysis shows that it is derived from the SMIM20 [small integral membrane protein 20] gene, which is encoded by C4orf52 [chromosome 4 open reading frame 52]. The precursor of Phoenixin has been identified as MITRAC7 [Mitochondrial translation regulation assembly intermediate of cytochrome c oxidase 7] (Dennerlein et al, 2015), a constituent of a late form of the MITRAC complex involved in the assembly of Cytochrome c oxidase, the terminal enzyme of the respiratory chain, and the regulation mitochondrial translation of
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |