RGLs |
RGMa |
FKFGSFIKRMWRSKLAKKLRAKGKELLRDYANRVLSPEEEAAAPAPVPA |
||
[repulsive guidance molecule] This GPI (glycosylphosphatidylinositol) anchored protein of 33 kDa has been identified by Muller et al (1996) as a protein involved in axon guidance of retinal ganglion neurons. Monnier et al (2002) have reported that RGM is a repulsive guidance molecule for retinal axons, repelling retinal axons upon activation of the neogenin receptor.
Niederkofler et al (2004) have identified three mouse proteins homologous to chick RGM. These proteins (RGMa [Repulsive guidance molecule A; RGM domain family member A], RGMb [Repulsive guidance molecule B
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |