Sea-blue histiocytes |
SEALAVDGAGKPGAEEAQDPEGKGEQEHSQQKEEEEEMAVVPQGLFRG |
Dido-2 |
||
[SEA domains, SEA module, SEA modules]
This domain of approximately 120 amino acids is named after three three proteins in which it was identified first: sea urchin sperm protein, enterokinase, and agrin (Bork and Patthy, 1995). Most of the proteins with SEA domains are membrane proteins and usually have only one SEA domain, which always exist in the extracellular region. The deletion of the SEA domain of perlecan affects heparan sulfate synthesis (Sasaki et al, 1998; Dolan et al, 1997). The SEA domain present in some mucins (Mucin 1, Mucin 3) has been shown to be the site of proteolyic cleavage, which generates extracellular and membrane components (Wreschner et al, 2002; Wang et al, 2002).
To date, no specific function has been designated
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |