SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF |
SVTLSLRLPFPS |
CRLR/RAMP2 |
||
also: (L)SVSVGMKPSPRP. This bioactive peptide, named L-SP5 and previously reported as SP5-52 (Lee et al, 2007), is a linear peptide discovered in an in vivo phage display screen aimed at finding peptides that recognize blood vessels in SCID mice bearing solid tumors. This peptide recognizes tumor neovasculature but not normal blood vessels. The peptide also binds human umbilical vein endothelial cells stimulated by VEGF and blood vessels of human
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |