COPE Media Kit


Cope Home
Previous entry:
SCAIF-1
Next entry:
Scallop antimicrobial peptide
Random entry:
CANDF2
Search COPE:

Scallop-AMP

[Scallop antimicrobial peptide] This peptide of 39 amino acids (MSGRGKGGKVKGKAKSRSSRAGLQFPVGRIHRLLRKGNY) corresponds to a sequence from the N-terminal region of histone H2A from scallop Chlamys farreri. The recombinant peptide shows activity of an antimicrobial peptide and is active against both Gram-positive bacteria (M. luteus) and Gram-negative bacteria (Vibrio splendidus, Vibrio anguillarum and Vibrio vulnificus). The expression of histone H2A in scallop hemocytes challenged by bacteria is not upregulated after stimulation, suggesting that histone H2A does not participate directly in immune responses. For bioactive fragments of histone proteins see also: HDAPs [ ... ... ... ... ... Subscribe to continue reading! ... ...

 

Content view restricted !

COPE - with 54500+ entries the most comprehensive cell-to-cell communication knowledge base

Extensive In-depth and In Context Information covering terminology, nomenclature, concepts, strategies & complexities of cellular communication, including Acute phase proteins | Angiogenesis | Antimicrobial & host defense peptides | Apoptosis & other forms of cell death | CD antigens | Cell lines | Cell reprogramming | Chemokines | Cryptides | Cytokines & Growth factors | CytokineTopics | Eukaryotic cell types & expression profiles | Hematopoiesis | Hormones | Inflamation & inflammatory mediators | Innate Immunity | Metalloproteinases | Microvesicles / Microparticles | Moonlighting proteins & cryptides | Neuropeptides | Non-coding RNAs | Pathogenicity & Virulence Factors | Pattern recognition receptors | Peptide sequences | Protein domains | Regulatory peptide factors | Viroceptors | Virokines and more.

Full COPEing for subscribers:

Access to Alphabet bar, Freetext search, Leafing/browsing functions, Internal Backlinking, Topic-specific introductions, Topic-specific integrated subdictionaries, Scientific references with PubMed links

with a 15 USD/month subscription at Cells-Talk.com

See example pages at the bottom of the Cells-Talk.com home page
THE SMART ONES COPE
The others just sisyphos around

 

Copyright © 1997-2021. All rights reserved by Dr H Ibelgaufts, the author of COPE - Cytokines & Cells Online Pathfinder Encyclopaedia

ENTRY LAST MODIFIED: December 2019



 
 
SUPPORT COPE | Intro | Subdictionaries | New Entries | Contribute data | COPE Credentials
# A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

              Created, developed, and maintained by Dr H Ibelgaufts              
About the author of COPE
  |    Contact COPE   |    Terms & Conditions


U L T R A   P O S S E    N E M O   O B L I G A T U R



cope.cgi Version 1.41 [08.12.2020]. (c) JI. Powered by Perl 5.032001. key=45032