Tutl |
TVDFGLARGYSGTQEAKHRMGLAAANFAGGP |
StemBios cells |
||
[Tephrosia villosa defensin-1] TvD1 is a plant defensin (75 amino acids) isolated from a weedy leguminous herb, Tephrosia villosa (Vijayan et al, 2008). The defensin is expressed constitutively in leaves, stems, roots, and seeds. Recombinant TvD1 shows potent antifungal activity against several filamentous soil-borne fungal pathogens. The purified peptide also shows significant inhibition of root elongation in Arabidopsis thaliana seedlings, subsequently affecting the extension of growing root hairs indicating that it has the potential to disturb the plant growth and development.
Vijayan et al (2012) have used site-directed mutagenesis to create a variant of TvD1, termed Alpha-TvD1
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |