Drosokinin |
drosomycin-1 |
VEGF decoy receptor FP3 |
||
Drosomycin, encoded by gene CG10810, is an inducible antibacterial peptide isolated from Drosophila melanogaster. The peptide (44 amino acids; DCLSGRYKGPCAVWDNETCRRVCKEEGRSSGHCSPSLKCWCEGC) (Levy et al, 2004) contains 8 cysteines engaged in intramolecular disulfide bridges. Drosomycin shows a significant homology with a family of 5 kDa cysteine-rich plant antifungal defensins from seeds of Brassicaceae (Fehlbaum et al, 1994). Drosomycin also shares the same array of intramolecular disulfide bridges with plant defensins (Michaut et al, 1996).
Drosomycin is produced primarily in the fat body and hemocytes during a systemic immune response and has potent antifungal activity but is inactive against bacteria. Activation of this systemic response requires
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |