EBNA-LP |
Ebola viral protein 24 |
QAFKTFTPDWNKIRNDAKRMQDNLEQMKKRFNLNL |
||
The cDNA for this rat protein has been identified by Li and Snyder (1995). The encoded protein is named after its expression in secretory duct epithelial cells of the lingual salivary glands known as von Ebner's glands. The protein is released onto the tongue surface along the apical region of taste buds in the clefts of circumvallate papillae. Sequence analysis shows that Ebnerin contains domains with homology to domains found in scavenger receptors and that it is the counterpart of the human DMBT1 [deleted in malignant brain tumors 1] gene. See: DMBT1 (approved gene symbol) for an overview of other bioactivities.
For other proteins/peptides with functions in innate immunity
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |