COPE Media Kit


Cope Home
Previous entry:
Mesosecrin
Next entry:
Mesothelin
Random entry:
QVLKYCPKIGYCSSKCSKAEVWAYSPDCKVHCCVPANQKW
Search COPE:

mesothelial cells

[mesothelial cell]

collective term for flattened epithelial cells of mesenchymal origin that form as monolayer lining the pleural, pericardial, and peritoneal cavities of the body (Michailova and Usunoff, 2006). Mesothelial cells secrete glycosaminoglycans and surfactant to allow the parietal and visceral serosa to slide over each other. The term M cells is used occasionally to describe mesentery-derived mesothelial cells.

The mesothelium is a dynamic cellular membrane with many important functions such as transport and movement of fluid and particulate matter, leucokyte migration in response to inflammatory mediators, synthesis of pro-inflammatory cytokines, growth factors and extracellular matrix ... ... ... ... ... Subscribe to continue reading! ... ...

 

Content view restricted !

COPE - with 54500+ entries the most comprehensive cell-to-cell communication knowledge base

Extensive In-depth and In Context Information covering terminology, nomenclature, concepts, strategies & complexities of cellular communication, including Acute phase proteins | Angiogenesis | Antimicrobial & host defense peptides | Apoptosis & other forms of cell death | CD antigens | Cell lines | Cell reprogramming | Chemokines | Cryptides | Cytokines & Growth factors | CytokineTopics | Eukaryotic cell types & expression profiles | Hematopoiesis | Hormones | Inflamation & inflammatory mediators | Innate Immunity | Metalloproteinases | Microvesicles / Microparticles | Moonlighting proteins & cryptides | Neuropeptides | Non-coding RNAs | Pathogenicity & Virulence Factors | Pattern recognition receptors | Peptide sequences | Protein domains | Regulatory peptide factors | Viroceptors | Virokines and more.

Full COPEing for subscribers:

Access to Alphabet bar, Freetext search, Leafing/browsing functions, Internal Backlinking, Topic-specific introductions, Topic-specific integrated subdictionaries, Scientific references with PubMed links

with a 15 USD/month subscription at Cells-Talk.com

See example pages at the bottom of the Cells-Talk.com home page
THE SMART ONES COPE
The others just sisyphos around

 

Copyright © 1997-2021. All rights reserved by Dr H Ibelgaufts, the author of COPE - Cytokines & Cells Online Pathfinder Encyclopaedia

ENTRY LAST MODIFIED: September 2011



 
 
SUPPORT COPE | Intro | Subdictionaries | New Entries | Contribute data | COPE Credentials
# A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

              Created, developed, and maintained by Dr H Ibelgaufts              
About the author of COPE
  |    Contact COPE   |    Terms & Conditions


U L T R A   P O S S E    N E M O   O B L I G A T U R



cope.cgi Version 1.41 [08.12.2020]. (c) JI. Powered by Perl 5.032001. key=33270