p60 |
p63 |
GIMSLFKGVLKTAGKHVAGSLVDQLKCKITGGC |
||
This is one of the designations referring to the alpha (55 kDa) subunit of the TNF-alpha receptor (see: TNF-alpha). In the nomenclature of CD antigens this subunit has been given the designation CD120a.
For additional information on CD antigens see also: CD antigens Dictionary.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |