small cardioactive peptide B |
small cartilage-derived glycoprotein |
SYSRYRKQMAVKKYLAAVLGKRYKQRVKNK |
||
Two such peptides, termed SCPA [small cardioactive peptide A] (ARPGYLAFPRMamide) and SCPB [small cardioactive peptide B] (MNYLSFPRMamide) have been identified in the mollusk Aplysia californica (Lloyd, 1982, 1986; Morris et al, 1982; Lloyd et al, 1987). They are derived from the same precursor (Mahon et al, 1985).
These peptides have been shown to be released by single identified Aplysia californica neurons in culture (Lloyd et al, 1986) and are thought to act as neurotransmitters / neurohormone
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |