very late activation antigen alpha-1 |
very late activation antigen alpha-3 |
KTCENLADTYKGPCFTTGSCDDHCKNKEHLRSGRCRDDFRCWCTKNC |
||
abbr. VLA-alpha 2. See: VLA-2 [very late activation antigen 2.
In the nomenclature of CD antigens this protein has been given the designation CD49b.
For additional information on CD antigens see also: CD antigens Dictionary.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |