ADAM10 |
ADAM12 |
CTTGPCCRQCKLKPAGTTCWKTSLTSHYCTGKSCDCPLYPG |
||
[a disintegrin and metalloprotease domain 11; ADAM metallopeptidase domain 11] This protein is known also by its gene symbol MDC [metalloproteinase-like disintegrin-like cysteine-rich protein]. The protein is a member of the ADAM protein family and was identified originally as a candidate tumor suppressor gene for human breast cancer. The protein is expressed widely and expression is high in the brain. The gene gives rise to an alternative truncated form. Sequence analysis suggests that ADAM11 is not a metalloprotease, since it lacks a catalytic motif (Sagane et al, 1998; Sagane et al, 1999). A zinc-binding motif, which is critical for proteinase
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |