aHDGF |
AHHFGKEFTPPVQAAYQKVVAGVANALAHKYH |
VEGF-A111b |
||
[AH domains]
[arfaptin homology domain] The AH domain comprises approximately 210 amino acids. This region of homology has been identified between arfaptins and PICK1 (protein interacting with C kinase 1) and (Takeya et al, 2001). Arfaptins are target proteins of the two G-proteins ADP-ribosylation factor and Rac. Arfaptin 1 (Kanoh et al, 1997) is a 39 kDa ARF-binding protein that is recruited to Golgi membranes and that inhibits in vitro activation of cholera toxin ADP-ribosyltransferase and phospholipase D (PLD) by ADP-ribosylation factor. (Willinger et al, 1999). Arfaptin 1 also inhibits endoplasmic reticulum/Golgi protein transport (Willinger et al, 1999). Arfaptin 1 inhibits ADP-ribosylation factor-dependent secretion of matrix metalloproteinase-9 induced by phorbol esters in HT 1080 fibrosarcoma
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |