ABH blood group antigens |
ABIN-1 |
Ser/Thr kinase receptor-2 |
||
This peptide (MSGRGKGGKTKAKAKSRSSRAGLQFPVGRIHRLLRKGNYA) corresponds to the 40 N-terminal amino acids of histone H2A (Histone H2A(1-40)) from the abalone Haliotis discus discus (De Zoysa et al, 2009). Abhisin shares 80 % amino acid identity with the buforin-1 peptide that is derived from Asian toad histone H2A. histone H2A transcription is induced significantly at 3 hours post-infection with bacteria in abalone gills and digestive tract.
Synthetic abhisin has been shown to be active against Gram-positive Listeria monocytogenes, Gram-negative Vibrio ichthyoenteri, and the yeast Pityrosporum ovale.
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |