Antiregulatory T-cells |
antisense oligonucleotides |
DCLSGRYKGPCAVWDNETCRRVCKEEGRSSGHCSPSLKCWCEGC |
||
Antisense RNAs (abbr. aRNAs); also: ASO, antisense oligonucleotides) is complementary to the mRNA transcribed from a gene (see also: gene expression). These anti-mRNAs, or shorter oligonucleotides derived from the sequence of the mRNA under study, can form complexes with the primary RNA transcript of a gene.
![]() |
The interaction of the antisense gene with its target is seen only when the target gene is expressed. The efficiency with which antisense RNA can be used to inhibit endogenous gene expression primarily not only depends on the synchronous or overlapping expression of the
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |