cDNA subtraction |
CDOPs |
CTTGPCCRQCKLKPAGTTCWKTSLTSHYCTGKSCDCPLYPG |
||
[conserved dopamine neurotrophic factor, cerebral dopamine neurotrophic factor] This protein has been identified by Lindholm et al (2007). In databanks the protein is found also as ARMETL1 [arginine-rich, mutated in early stage tumors-like 1]. CDNF acts as a trophic factor for dopamine neurons. CDNF is expressed in several tissues of mouse and human, including the mouse embryonic and postnatal brain. In vivo, CDNF prevents the degeneration of dopaminergic neurons induced by 6-hydroxydopamine, a rat experimental model of Parkinson's disease, and almost completely rescues dopaminergic cells
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |