CXCL3-like |
CXCL4L1 |
HSDATFTAEYSKLLAKLALQKYLESILGSSTSPRPPSS |
||
[chemokine (C-X-C motif) ligand 4] approved gene symbol for a member of a group of cytokines generally known as chemokines. Members of this group of so-called CXC-Chemokines belong to the SCY family of cytokines and are designated CXCL (L for ligand) followed by a number (Zlotnik and Yoshie, 2000).
CXCL4 has been identified independently as PF4 [platelet factor-4]. An older designation is SCYB4 [small inducible cytokine subfamily B member 4].
Aidoudi et al (2008) have shown that CXCL4 interacts with integrin-alpha-V / integrin-beta-3. Human umbilical vein endothelial cells
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |