Calcitermin |
calcitonin 1 |
Mothers against decapentaplegic homolog 6 |
||
abbr. CT; also: CTN. This peptide hormone, CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP, synthesized by C-cells of the thyroid and called Thyrocalcitonin in older references (see, for example, Hirsch et al (1964), who described Thyrocalcitonin as a hypocalcemic hypophosphatemic principle that lowers serum calcium and inorganic phosphate in rats), is encoded by the CALCA [calcitonin-related polypeptide-alpha] gene, which is being referred to also as CALC1 [calcitonin 1
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |