COPE Media Kit


Cope Home
Previous entry:
Candida albicans metacaspase-1
Next entry:
Candidate Plasticity Gene 15
Random entry:
BR3
Search COPE:

Candidalysin

Candidalysin (SIIGIIMGILGNIPQVIQIIMSIVKAFKGNK) is a cytolytic peptide toxin secreted by the invasive form of the human pathogenic fungus, Candida albicans (Moyes et al, 2016). Candidalysin directly damages and permeabilises the membranes ofepithelial cells, which triggers an inward current concomitant with calcium influx. Candida albicans strains lacking this toxin do not activate or damage epithelial cells and are avirulent in animal models of mucosal infection.

Candidalysin has been shown to activate the EGF receptor (EGFR) in oral epithelial cells (Ho et al, 2019), which activates danger response signalling pathways and activates epithelial immunity. This is accompanied, among other things, by the release of inflammatory ... ... ... ... ... Subscribe to continue reading! ... ...

 

Content view restricted !

COPE - with 54500+ entries the most comprehensive cell-to-cell communication knowledge base

Extensive In-depth and In Context Information covering terminology, nomenclature, concepts, strategies & complexities of cellular communication, including Acute phase proteins | Angiogenesis | Antimicrobial & host defense peptides | Apoptosis & other forms of cell death | CD antigens | Cell lines | Cell reprogramming | Chemokines | Cryptides | Cytokines & Growth factors | CytokineTopics | Eukaryotic cell types & expression profiles | Hematopoiesis | Hormones | Inflamation & inflammatory mediators | Innate Immunity | Metalloproteinases | Microvesicles / Microparticles | Moonlighting proteins & cryptides | Neuropeptides | Non-coding RNAs | Pathogenicity & Virulence Factors | Pattern recognition receptors | Peptide sequences | Protein domains | Regulatory peptide factors | Viroceptors | Virokines and more.

Full COPEing for subscribers:

Access to Alphabet bar, Freetext search, Leafing/browsing functions, Internal Backlinking, Topic-specific introductions, Topic-specific integrated subdictionaries, Scientific references with PubMed links

with a 15 USD/month subscription at Cells-Talk.com

See example pages at the bottom of the Cells-Talk.com home page
THE SMART ONES COPE
The others just sisyphos around

 

Copyright © 1997-2021. All rights reserved by Dr H Ibelgaufts, the author of COPE - Cytokines & Cells Online Pathfinder Encyclopaedia

ENTRY LAST MODIFIED: November 2020



 
 
SUPPORT COPE | Intro | Subdictionaries | New Entries | Contribute data | COPE Credentials
# A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

              Created, developed, and maintained by Dr H Ibelgaufts              
About the author of COPE
  |    Contact COPE   |    Terms & Conditions


U L T R A   P O S S E    N E M O   O B L I G A T U R



cope.cgi Version 1.41 [08.12.2020]. (c) JI. Powered by Perl 5.032001. key=7505