Candida albicans metacaspase-1 |
Candidate Plasticity Gene 15 |
BR3 |
||
Candidalysin (SIIGIIMGILGNIPQVIQIIMSIVKAFKGNK) is a cytolytic peptide toxin secreted by the invasive form of the human pathogenic fungus, Candida albicans (Moyes et al, 2016). Candidalysin directly damages and permeabilises the membranes ofepithelial cells, which triggers an inward current concomitant with calcium influx. Candida albicans strains lacking this toxin do not activate or damage epithelial cells and are avirulent in animal models of mucosal infection.
Candidalysin has been shown to activate the EGF receptor (EGFR) in oral epithelial cells (Ho et al, 2019), which activates danger response signalling pathways and activates epithelial immunity. This is accompanied, among other things, by the release of inflammatory
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |