C-PTH |
cpto |
bone marrow stem cells |
||
[cowpea gamma-thionin 2] Cp-thionin II (KTCMTKKEGWGRCLIDTTCAHSCRKYGYMGGKCQGITRRCYCLLNC) is an antimicrobial peptide belonging to the family of plant defensins. The peptide has been purified from cowpea seeds (Vigna unguiculata) (Franco et al, 2006). Cp-thionin II has been shown to be bactericidal for Gram-positive bacteria and Gram-negative bacteria.
For other proteins/peptides with functions in innate immunity and/or antimicrobial activities see also: Innate immunity and defense peptides Dictionary.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |