D2-40 antigen |
DAAP |
CYQRRVAITAGGLKHRLMSSLIIIIIIRINYLRDNSVIILESSY |
||
A transformed murine lymphoblastic cell line. This cell line has been used to identify and to isolate LIF which was known previously as HILDA (human interleukin for Da cells) (Moreau et al, 1988). The cell line is used, therefore, also to detect this factor.
Da cells are dependent upon IL3, and GM-CSF for survival and growth (see also: Factor-dependent cell lines). Da cells are stimulated to proliferate also by murine and human Epo (Branch et al, 1990; Broudy et al, 1990; Tsuda et al, 1989). Antibodies to Epo
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |