EASPRVSRRYGRPFGGRPFVGGQFGGRPGCVCIRSPCPCANYG |
Easter |
Kell blood group antigen |
||
[epidermal growth factor receptor-associated protein with SH3 and TAM domains]. The protein is the same as STAM-2 [signal-transducing adaptor molecule-2].
This cytoplasmic chicken protein of 68 kDa contains a src homology domain-3 domain in its midregion and a tyrosine-based activation motif in its COOH terminus (Lohi et al, 1998). The protein is present in most chicken tissues. The protein interacts with the EGF receptor in an EGF dependent manner and become tyrosine-phosphorylated by the receptor.
EAST is probably involved in EGF signaling and in the endocytotic machinery as it has been shown to interact with eps15, an EGF receptor
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |