ELABELA |
Elafin-like protein I |
MAPK/ERK kinase 2 |
||
Wiedow et al (1990) have proposed the name Elafin (AQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ) for a potent inhibitor of human leukocyte elastase and porcine pancreatic elastase purified from human horny skin layers. Wiedow et al (1990) have suggested that Elafin may play a functional role in preventing tissue proteolysis mediated by elastase. This inhibitor is variously being referred to also as
EIA [Elastase inhibiting activity]
ESI [Elastase-specific inhibitor]
SKALP [Skin-derived antileukoproteinase]
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |