FPV016 protein |
FPV080 |
QGVRNHVTCRIYGGFCVPIRCPGRTRQIGTCFGRPVKCCRRW |
||
[fowlpox virus 039 protein] FPV039 is encoded in the genome of fowlpox virus. The protein shows limited homology with the anti-apoptotic protein BCL2 and inhibits cell death by apoptosis in response to a variety of cytotoxic stimuli, including virus infection. FPV039 is localized predominantly to the mitochondria in human and chicken cells and protects human cells from loss of the mitochondrial membrane potential induced by TNF-alpha. FPV039 interacts constitutively with the pro-apoptotic protein, BAK in human and chicken cells (Banadyga et al, 2007).
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |