Fc alpha/microR |
Fc alpha/mu receptor |
PPPVIKFNRPFLMWWIVERDTRSILFMGKIVNPKAP |
||
[Fc fragment of IgA and IgM receptor; High affinity immunoglobulin alpha and immunoglobulin mu Fc receptor, Fc alpha/mu receptor] see: FCAMR.
In the nomenclature of CD antigens the receptor has been given the designation CD351.
For additional information on CD antigens see also: CD antigens Dictionary.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |