hemolysin BL |
hemopexin domains |
RADTQTYQPYNKDWIKEKIYVLLRRQAQQAGK |
||
abbr. HPX, Hpxn, Hx. Hemopexin sequences have been reported by Altruda et al (1985, 1988) and Takahashi et al (1985). Human hemopexin (63 kDa; 439 amino acids) consists of two domains joined by a linker sequence (see also: hemopexin domain).
Another designation for this protein is Beta-1B-glycoprotein. The protein has been identified independently as LB and chicken alpha 1-globulin M. Stred and Messina (2003) have identified hemopexin as growth hormone inducible genes (termed GIG-3, GIG-7 and GIG-12) in rat liver in vivo and in cultured rat
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |