IFN-gamma inducible protein 10 |
IFN-gamma inducing factor |
LFCRKGTCHFGGCPAHLVKVGSCFGFRACCKWPWDV |
||
This protein has been identified in transformed human amnion cells (Fleckner et al, 1991). It is expressed highly in response to IFN-gamma but not IFN-alpha. Sequence comparison shows that the protein is highly homologous to rabbit peptide chain release factor and bovine Tryptophanyl-tRNA synthetase. The protein has been shown to possess Tryptophanyl-tRNA synthetase activity and is thought to be the human equivalent of the synthetase.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |