IVSYPDDAGEHAHKMGamide |
IWDAIFHGAKHFLHRLVNPGGKDAVKDVQQKQ |
F1A-alpha |
||
This type of interneurons, named after their dense and fine axons innervating mostly basal and oblique pyramidal cell dendrites, has been described by Fuentealba et al (2008). The cells are GABAergic neurons found in the cerebral cortex, express the neuronal isoform of nitric oxide synthase, neuropeptide Y, and high levels of GABA(A) receptor alpha-1 subunit, and regulate the excitability of pyramidal cell dendrites through slowly rising and decaying GABAergic inputs. Krook-Magnuson et al (2011) have reported that Ivy cells display the phenomenon of persistent firing, a state of continued firing in the absence of continued input, and that induction of persistent firing is inhibited by mu opioid receptor activation.
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |