LRGLLCYCRKGHCKRGERVRGTCGIRFLYCCPRR |
LRHG |
src homology domain-2 |
||
Three lectins, termed CSL1 [chum salmon lectin 1], CSL2 [chum salmon lectin 2] and CSL3 [chum salmon lectin 3], have been isolated from chum salmon (Oncorhynchus keta). Similar lectins are found in various kinds of fish and invertebrates. These lectins interact with various kinds of bacteria, suggesting a function as pattern recognition receptors and an involvement in various inflammatory reactions and innate immunity. All three lectins recognize Globotriaosylceramide Gb3 and induce the synthesis of
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |