MIR7 |
mir-14 |
LSEDMPATPADQEMYQPDPEEMESRTRYFSPRL |
||
[monocyte/macrophage immunoglobulin-like receptor 10] The gene encoding this protein has been cloned as cDNA by Wagtmann et al (1997). The gene has received the approved gene symbol LILRB2. The gene has been cloned independently as The gene has been cloned independently as ILT4 [immunoglobulin-like transcript 4], and LIR2 [leukocyte immunoglobulin-like receptor 2].
In the nomenclature of CD antigens this protein has been given the designation CD85d. See: CD85
For additional information on CD antigens see also: CD antigens Dictionary.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |