RAGLQFPVGRLLRRLLR |
ragocytes |
GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ |
||
for this cell-penetrating peptide derived from histone H2A, termed buforin IIb, see: buforins.
For other proteins (or fragments thereof) with at least one additional activity that differs from the established 'classical' activity of the parent protein see also: Dual identity proteins and Cryptides MiniCOPE Dictionary.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |