Royalactin |
RoY peptide |
lymphocyte antigen 9-beta |
||
Royalisin (VTCDLLSFKGQVNDSACAANCLSLGKAGGHCEKVGCICRKTSFKDLWDKRF) has been found in royal jelly of the honeybee Apis mellifera (Fujiwara et al, 1990). Royalisin is a peptide of 51 residues and three intramolecular disulfide linkages. Klaudiny et al (2005) have reported that royalisin is identical with a defensin found in the hemolymph of bacterially infected bees. Both peptides are encoded by the same polymorphic gene, which the authors have termed defensin1 (see also: defensins).
Royalisin shows extensive sequence homology to two other antibacterial proteins, sapecin and phormicins. The peptide possesses potent antibacterial activity against Gram-positive bacteria, but not against
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |