SIGLEC-4A |
SIGLEC-6 |
EASPRVSRRYGRPFGGRPFVGGQFGGRPGCVCIRSPCPCANYG |
||
[sialic acid binding immunoglobulin-like lectin 5] This protein is a member of a family of type 1 transmembrane proteins. They are cell surface lectins that have the ability to bind to sialic acids and mediate interactions between proteins and carbohydrates (see also: SIGLECs). Several studies describing the sialoside specificities of individual SIGLECs have been reported (Blixt et al, 2003; Rapoport et al, 2006).
SIGLEC-5 (551 amino acids) has been identified by Cornish et al (1998). It has been identified independently as Ob binding protein 2 (OBBP2) by Patel et al (1999) who also observed weak binding to leptin. The protein is related to CD33 and has been termed CD33L2 [
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |